DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and CG43066

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001246408.1 Gene:CG43066 / 37129 FlyBaseID:FBgn0262476 Length:721 Species:Drosophila melanogaster


Alignment Length:188 Identity:41/188 - (21%)
Similarity:75/188 - (39%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GGSLALAARRIRSRQVHSMAVRTGSAYDTLERPYR----------HDKCRGRWAKSADFYFASCT 99
            |..:|....|.|....|.:.:       .|..|.|          ::..|..|:....|:.:...
  Fly    13 GHEMAPLNTRARGDGTHGVTI-------VLTAPQRNSVQSVDIPGNEPERAAWSGKMQFFLSIIG 70

  Fly   100 HAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VA 160
            :   |:....:..|..|   :||. .|:|.:::.::...:|:|||:..:||....|.:..:. :.
  Fly    71 Y---SVGLGNIWRFPYLCQQNGGG-AFLIPFMVMLILEGIPLFLIELGIGQRMRLGALGVWNTIH 131

  Fly   161 PIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC---NNSWNTQECS 215
            |...|||.:..::.|....||::.......|..||....:||.||   ...:..:||:
  Fly   132 PWLGGIGISSCIVTLFVALYYNVIITWVFFYLFNSFRYPLPWSSCPLNGTGFELEECA 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 25/97 (26%)
Cuticle_4 276..344 CDD:292577
CG43066NP_001246408.1 SLC6sbd-B0AT-like 55..617 CDD:271364 33/139 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.