DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and bdg

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster


Alignment Length:247 Identity:54/247 - (21%)
Similarity:100/247 - (40%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGDCE--NSEHGTELPGDFIGEPVETESGGGMGGSLALAARRIRSRQVHSMAVRTGSAYDTLER 76
            ::..|.  :|...:.:|     .||...|.....|| :.|........|.:..:.:.|:...||.
  Fly   421 IMSTCSELSSARSSRMP-----SPVSLPSDSSSSGS-SSAEHDQEPDPVQTTTMCSASSTTPLEP 479

  Fly    77 PYR-----HDKC--RGRW--AKSADFYFASCT-HAFSSLIFSELSTFGILHGGWLLFIIAYLMGM 131
            .::     .:||  ..:|  |.|.......|| ..|:...|:.|:   |..||  .|::.:|:..
  Fly   480 LHQLQLLLREKCGFNSQWPHAGSRTLALIGCTLGVFNMCRFAVLT---INFGG--NFLLQFLLLS 539

  Fly   132 LFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSI 196
            :.:.:|:..:|..||....:|.:|.::::||..|:|.|:::.......|.:::....|:|    :
  Fly   540 VIFGIPLLWLQMCLGAKIRAGPVSMWKISPICAGVGIALVMQQCFLALYSTVSLAWILVY----L 600

  Fly   197 HPVIPWMSCNNSWNTQECSLHENYDVD-------------FAVAVIFTLALA 235
            ..|.| .:..:.:..||.:....||..             |.|.|:..|.||
  Fly   601 RDVFP-TAARSGYRWQEMAFPYRYDASNATGNLTQTVAEYFNVVVLQRLHLA 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 28/126 (22%)
Cuticle_4 276..344 CDD:292577
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356 37/161 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.