DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and CG13795

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001285712.1 Gene:CG13795 / 34049 FlyBaseID:FBgn0031937 Length:594 Species:Drosophila melanogaster


Alignment Length:150 Identity:63/150 - (42%)
Similarity:91/150 - (60%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SAYDTLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLF 133
            ::|||..:|:..|..||:|.|..||.||....|....:|  :::|.:.....:|.|:.|.:.|..
  Fly     5 TSYDTGHKPFSPDLNRGKWDKPTDFMFACFGLALKLDVF--VASFWMFFDMGILGILPYFVYMSI 67

  Fly   134 YSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHP 198
            |.:||.:|.:|:|||||||.|||||::|.|||:||....|.:..|.||||.|.|||::.:||..|
  Fly    68 YLVPIMVIHSFMGQFSSSGFISAFRLSPFFKGMGYVSGFLTISMLIYYSIFAAVPLLFIINSFRP 132

  Fly   199 VIPWMSCN--NSWNTQECSL 216
            .:|| ||.  :||:....:|
  Fly   133 TLPW-SCEGLSSWHNGSATL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 45/95 (47%)
Cuticle_4 276..344 CDD:292577
CG13795NP_001285712.1 SLC5-6-like_sbd 27..505 CDD:271356 53/127 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473191
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.