DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and CG13794

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_609137.2 Gene:CG13794 / 34048 FlyBaseID:FBgn0031936 Length:595 Species:Drosophila melanogaster


Alignment Length:234 Identity:82/234 - (35%)
Similarity:117/234 - (50%) Gaps:44/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SAYDTLERPYRHDKCRGRWAKSADFYFASCTHAF-------SSLIFSELSTFGILHGGWLLFIIA 126
            ::||:..:|:..|..||:|.|..|:.||....|.       |...|.::..||:|         .
  Fly     5 TSYDSGHKPFSPDLKRGKWDKPTDYIFACFGLALKLDIFVASYWFFFDMGIFGML---------P 60

  Fly   127 YLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIY 191
            ||:.|:.|.:||.:|.:|:|||||||.|||||::|.|||:||..:.|.:..|.||||.|.|||::
  Fly    61 YLVYMVIYLVPIMVIHSFMGQFSSSGFISAFRLSPFFKGMGYVSVFLTISMLIYYSIFAAVPLLF 125

  Fly   192 TVNSIHPVIPWMSCN--NSWNTQE------CS------LHENYD--VDF------AVAVIFTLAL 234
            .:||..|.:|| ||.  .||..:.      |:      |.:|.|  .||      ..:|::.|..
  Fly   126 MINSFRPTLPW-SCEGFKSWYNESDGKMTTCNMTISEDLTDNSDNNTDFHRPHFHVPSVLYFLKH 189

  Fly   235 AMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPA 273
            ...||......|.|  .:.||:..||...:|   ||:.|
  Fly   190 FESVQEENYSDLRQ--DYDLSWRFVSLFVLV---WAMVA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 55/141 (39%)
Cuticle_4 276..344 CDD:292577
CG13794NP_609137.2 SLC5-6-like_sbd 27..509 CDD:271356 74/212 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.