DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and CG13793

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_609136.2 Gene:CG13793 / 34047 FlyBaseID:FBgn0031935 Length:583 Species:Drosophila melanogaster


Alignment Length:136 Identity:58/136 - (42%)
Similarity:83/136 - (61%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            :|:..|..||.|.|..|:.||....|....||  :::|.......:..::.|||.|:.|.:||.:
  Fly     4 KPFSPDLNRGNWEKPTDYIFACFGLALKLDIF--VASFWFFFNTGIFGMVPYLMYMVIYLVPIMV 66

  Fly   141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            |.:::|||||||.|||||::|:|||:||..|.|.:..|.||:|.|.|||::.:||..|.:|| ||
  Fly    67 IHSYMGQFSSSGFISAFRLSPLFKGMGYVSLFLTITLLIYYTIFAAVPLLFVLNSFRPTLPW-SC 130

  Fly   206 N--NSW 209
            .  .||
  Fly   131 EGFKSW 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 45/89 (51%)
Cuticle_4 276..344 CDD:464954
CG13793NP_609136.2 SLC5-6-like_sbd 19..498 CDD:271356 52/121 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.