DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Ntl

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_609135.1 Gene:Ntl / 34046 FlyBaseID:FBgn0267326 Length:590 Species:Drosophila melanogaster


Alignment Length:169 Identity:47/169 - (27%)
Similarity:78/169 - (46%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL--HGGWLLFIIAYLMGMLFYSLP 137
            ::....|:.||:|...::|..:...:|..   ...:..|..|  ..|...|:|.||:.::...:|
  Fly    15 DKRIERDENRGQWKSKSEFILSLLGYAIG---IGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIP 76

  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202
            :|.::..:|||||:|....||:.|:.||.|.|.:::|...:.|||:....|:..........:||
  Fly    77 LFYMEILIGQFSSTGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPW 141

  Fly   203 MSCNNSWNTQECSLHENYDVDFAVAVIFTLALAMGVQSS 241
            ..|:|||||.:|                ..|..||.|:|
  Fly   142 EDCSNSWNTDDC----------------VTASDMGKQNS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 38/119 (32%)
Cuticle_4 276..344 CDD:292577
NtlNP_609135.1 SLC5-6-like_sbd 24..554 CDD:294310 46/160 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.