DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and ine

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001162871.1 Gene:ine / 33659 FlyBaseID:FBgn0011603 Length:943 Species:Drosophila melanogaster


Alignment Length:137 Identity:37/137 - (27%)
Similarity:65/137 - (47%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 WAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQA 143
            ||....|..|...::        |..:.:..        ||. :|::.|.:.:...|:|:..::.
  Fly   340 WANKMQFVLACIGYSVGLGNVWRFPYMCYKS--------GGG-VFLVPYCIILFICSIPLLFMEL 395

  Fly   144 FLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNN 207
            .:||::..|.|.|. ::.|:|||.|.|.::::....||||:.....:.|...|....:||:.|||
  Fly   396 SVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNN 460

  Fly   208 SWNTQEC 214
            .|||.:|
  Fly   461 RWNTPDC 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 30/93 (32%)
Cuticle_4 276..344 CDD:292577
ineNP_001162871.1 SLC5-6-like_sbd 337..876 CDD:294310 37/137 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.