DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and slc6a19b

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_956030.1 Gene:slc6a19b / 326030 ZFINID:ZDB-GENE-030131-4755 Length:651 Species:Danio rerio


Alignment Length:149 Identity:37/149 - (24%)
Similarity:65/149 - (43%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQAFL 145
            |.:|...|. |..:|......|  ..:..|..|   |||. .|:|.:|:.::|..:|:..::..:
Zfish    33 RPKWDNKAQ-YMLTCVGFCVGL--GNVWRFPYLCQSHGGG-AFMIPFLILLVFEGIPLLHLEFAI 93

  Fly   146 GQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC---- 205
            ||....|::..:| :.|...|:|.|.:.::.....||:......:.|..||....:||..|    
Zfish    94 GQRLRKGSVGVWRTINPYMLGVGIASMCVSFLVSLYYNTIIAWVMWYFFNSFQDPLPWSQCPINE 158

  Fly   206 NNSWNTQECSLHENYDVDF 224
            |.:....||.  ::..||:
Zfish   159 NRTGPIPECG--KSSPVDY 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 26/107 (24%)
Cuticle_4 276..344 CDD:292577
slc6a19bNP_956030.1 SLC6sbd_B0AT1 33..613 CDD:212085 37/149 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.