DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a14

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_038955501.1 Gene:Slc6a14 / 298340 RGDID:1561810 Length:646 Species:Rattus norvegicus


Alignment Length:140 Identity:42/140 - (30%)
Similarity:74/140 - (52%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            ||.|:|.:|:..:...:|        |..|.::        :||. .|:|.|.:.:....||:|.
  Rat    42 RGNWSKKSDYLLSMVGYAVGLGNVWRFPYLTYT--------NGGG-AFLIPYAIMLALAGLPLFF 97

  Fly   141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            ::..||||:|.|.:|.:|:.|:|:|:|..::|:::....||::.....|.|...|...|:||.:|
  Rat    98 LECSLGQFASLGPVSVWRILPLFQGVGITMVLISIFVTIYYNVIIAYSLYYLFASFQSVLPWANC 162

  Fly   206 NNSWNTQECS 215
            ::||....||
  Rat   163 SSSWADDNCS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 32/93 (34%)
Cuticle_4 276..344 CDD:464954
Slc6a14XP_038955501.1 SLC6sbd_ATB0 42..645 CDD:271391 42/140 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.