DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a18

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_058859.2 Gene:Slc6a18 / 29323 RGDID:69352 Length:615 Species:Rattus norvegicus


Alignment Length:148 Identity:39/148 - (26%)
Similarity:64/148 - (43%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSL 136
            |||        :|..... |..||......|  ..:..|..|   |||. .|:|.|.:.::|..:
  Rat    16 ERP--------KWDNKLQ-YLLSCIGFAVGL--GNIWRFPYLCHTHGGG-AFLIPYFIALVFEGI 68

  Fly   137 PIFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVI 200
            |:|.|:..:||....|:|..:: ::|...|:|.....::.....||:...:..|.:.:||....:
  Rat    69 PLFYIELAIGQRLRRGSIGVWKTISPYLGGVGLGCFSVSFLVSLYYNTILLWVLWFFLNSFQHPL 133

  Fly   201 PWMSC----NNSWNTQEC 214
            ||.:|    |.:...|||
  Rat   134 PWSTCPLDLNRTGFVQEC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 26/97 (27%)
Cuticle_4 276..344 CDD:292577
Slc6a18NP_058859.2 SLC6sbd_B0AT3 16..591 CDD:212086 39/148 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.