DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SLC6A16

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_011525161.2 Gene:SLC6A16 / 28968 HGNCID:13622 Length:781 Species:Homo sapiens


Alignment Length:398 Identity:75/398 - (18%)
Similarity:139/398 - (34%) Gaps:122/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ARRIRSRQVHSMAVRTGSAYDTLERPYRHDK-------------CRGRWAKSADFYFA------- 96
            ||..:.:|:..:...|.||.:  ::| .|:|             .|..|:...::..|       
Human   143 ARTSQPKQISVLEALTASALN--QKP-THEKVQMTEKKESEVLLARPFWSSKTEYILAQVGFSMK 204

  Fly    97 -SCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-V 159
             ||...|:.|         .|:.|...|...|:..:....:|:..::...||....|.:..:: :
Human   205 PSCLWRFAYL---------WLNSGGCSFAAIYIFMLFLVGVPLLFLEMAAGQSMRQGGMGVWKII 260

  Fly   160 APIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC----NNSWNTQEC------ 214
            ||...|:||:..::......|:::.....:.|...|....:||..|    |:|....||      
Human   261 APWIGGVGYSSFMVCFILGLYFNVVNSWIIFYMSQSFQFPVPWEKCPLTMNSSGFDPECERTTPS 325

  Fly   215 -------SLHENYDVDFAVAVIFTLALAM-------------GVQSS-------VIPLLSQVAGH 252
                   :|..:..::...:.:::|.|..             |::|:       .:.:.|...|.
Human   326 IYFWYQQALKASDRIEDGGSPVYSLVLPFFLCWCLVGAFMINGLKSTGKISDVYNMSVWSLAGGQ 390

  Fly   253 GLSYTAVSGPAVVASPWAVPAAHWPAAVNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPSVVVAP 317
            .||.|.: |...|||              :||:.|.:.:..:.|.|.            ||:   
Human   391 VLSNTGI-GLGSVAS--------------LASYMPQSNNCLSDAFLV------------SVI--- 425

  Fly   318 VAHSGVYTAQTRGAIHTAPL---AGHILHQCRSRTRNLVRSIPPSIPLSIGPLPLPRILPLMGKS 379
                .:.|.....:.:...|   |..|.|:|..|...::..:     :::|.|| |...|     
Human   426 ----NLLTLLVFTSFNFCVLGFWATVITHRCCERNAEILLKL-----INLGKLP-PDAKP----- 475

  Fly   380 NFRPLNTL 387
               |:|.|
Human   476 ---PVNLL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 26/157 (17%)
Cuticle_4 276..344 CDD:292577 11/70 (16%)
SLC6A16XP_011525161.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.