DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a4

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_037166.2 Gene:Slc6a4 / 25553 RGDID:3714 Length:630 Species:Rattus norvegicus


Alignment Length:334 Identity:80/334 - (23%)
Similarity:134/334 - (40%) Gaps:97/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNNCMLLGDCENSEHGTELPGDFIGEPVETESGGGMGGSLALAARRIRSRQVHS--MAVRTGSAY 71
            ||:..:|.:|::.|              :.:..|.:...:...|.|....|:.:  .||.:.||.
  Rat     6 LNSQKVLSECKDRE--------------DCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAG 56

  Fly    72 D-----------TLERPYRHDKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILH 117
            |           ||....|..: |..|.|..||..:...:|        |..:.:.        :
  Rat    57 DEASHSIPAATTTLVAEIRQGE-RETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQ--------N 112

  Fly   118 GGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYY 181
            ||. .|::.|.:..:|..:|:|.::..|||:..:|.||.:| :.||||||||||.::.....:||
  Rat   113 GGG-AFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYY 176

  Fly   182 SIAAVVPLIYTVNSIHPVIPWMSCNNSWNTQECS----------------------------LHE 218
            :......|.|.::|:...:||.||.|||||..|:                            :|:
  Rat   177 NTIIAWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIHQ 241

  Fly   219 ----------NYDVDFAVAVIFTL---ALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWA 270
                      ::.:...:.:|||:   ::..||::|         |..:..|| :.|.:|.|...
  Rat   242 SKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTS---------GKVVWVTA-TFPYIVLSVLL 296

  Fly   271 VPAAHWPAA 279
            |..|..|.|
  Rat   297 VRGATLPGA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 44/161 (27%)
Cuticle_4 276..344 CDD:292577 2/4 (50%)
Slc6a4NP_037166.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..60 9/36 (25%)
5HT_transport_N 24..64 CDD:397524 9/39 (23%)
SLC6sbd_SERT 79..615 CDD:271399 63/246 (26%)
Interaction with RAB4A. /evidence=ECO:0000250 616..624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.