DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a11

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_766478.1 Gene:Slc6a11 / 243616 MGIID:95630 Length:627 Species:Mus musculus


Alignment Length:274 Identity:58/274 - (21%)
Similarity:87/274 - (31%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRLASHDSTRVTIAFFAVSGLDVLDSLHMLTDTFQQDICNWIYKLQVVPKPGERGYGGIQGSSTF 92
            |.:|.||.|:..:|    ..|:......:|.....|. ...:.....:|.|.......::|....
Mouse  3877 GLIAGHDVTKGLLA----RPLEFKAEEELLAQALAQG-PKTVNVPASLPTPPHNNQEELRGQEHC 3936

  Fly    93 DVIGTPDS----------CGLQLYRWGHLAITYTG---------IAVLVALGDDLSRLNRRAIIE 138
            :...||||          .|:::.|:..|::....         |.:.....|...:|..     
Mouse  3937 EDRNTPDSFVPSSSPESVVGMEISRYPDLSLVKEEPPSPAMSPVIPMFPVFRDKDVKLQE----- 3996

  Fly   139 GVAAVQRE------DGSFSATIEGSEQDMRFVYCAAAICAMLNDWGRVDRKKMADYILKSIRYDY 197
                |:.|      |.||.:...||...:      .:|..||......:...:...|...||.. 
Mouse  3997 ----VKTEPSSVFFDSSFRSVQNGSNTGL------VSIAIMLKPAAAENITDVVAAIADLIRVK- 4050

  Fly   198 GISQHYEMESHGGTTFCAI-----------------AALELSGQLHLLSADTRDKIIRWLVFRQQ 245
             |...||:.|..|.:|.||                 .||..:.| |||.....:|.|....:|  
Mouse  4051 -IPSSYEVSSGPGGSFGAIKTSVDPQCLASALPNGPRALRQAPQ-HLLLQHNHNKNIGGEQYR-- 4111

  Fly   246 DGFQGRPNKPVDTC 259
            || |.||......|
Mouse  4112 DG-QVRPGSKQQWC 4124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 31/142 (22%)
Cuticle_4 276..344 CDD:464954
Slc6a11NP_766478.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
SLC6sbd_GAT3 44..585 CDD:212077
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.