Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848818.1 | Gene: | Slc6a1 / 232333 | MGIID: | 95627 | Length: | 599 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 54/205 - (26%) |
---|---|---|---|
Similarity: | 91/205 - (44%) | Gaps: | 29/205 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGILHG--GWLLFIIAYLMGMLFYSLPIFLIQAFLG 146
Fly 147 QFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNT 211
Fly 212 QECSLHENYDVDFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHW 276
Fly 277 PAAVNVA-SW 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 37/119 (31%) |
Cuticle_4 | 276..344 | CDD:292577 | 5/11 (45%) | ||
Slc6a1 | NP_848818.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
SLC6sbd_GAT1 | 2..599 | CDD:212075 | 54/205 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 577..599 | ||||
PDZ-binding | 597..599 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11616 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |