DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a17

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001280618.1 Gene:Slc6a17 / 229706 MGIID:2442535 Length:727 Species:Mus musculus


Alignment Length:265 Identity:57/265 - (21%)
Similarity:97/265 - (36%) Gaps:71/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NSEHGTELPGDFIG--EPVETES-----GGGMGGSLALAARRIRSRQVHSMAVRTGSAYDTLERP 77
            ::||.||...|.:.  |||:.:.     .|..||...:|...:                ||.:||
Mouse    13 SNEHVTESVADLLALEEPVDYKQSVLNVAGETGGKQKVAEEEL----------------DTEDRP 61

  Fly    78 YRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIF 139
                    .|.....:..|....   |:....:..|..|   :||. .:::.||:.::...:|:|
Mouse    62 --------AWNSKLQYILAQIGF---SVGLGNIWRFPYLCQKNGGG-AYLVPYLVLLIIIGIPLF 114

  Fly   140 LIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWM 203
            .::..:||....|:|..:. |.|...|||::..::.|....||::.....:.|...|....:||.
Mouse   115 FLELAVGQRIRRGSIGVWHYVCPRLGGIGFSSCIVCLFVGLYYNVIIGWSVFYFFKSFQYPLPWS 179

  Fly   204 SCNNSWN------TQEC-------------------SLHE----NYDVDFAVAV---IFTLALAM 236
            .|....|      ..||                   |:.|    |:.:...:.|   |..:|:..
Mouse   180 ECPVIRNGTVAVVEPECEKSSATTYFWYREALDISNSISESGGLNWKMTLCLLVAWSIVGMAVVK 244

  Fly   237 GVQSS 241
            |:|||
Mouse   245 GIQSS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 34/152 (22%)
Cuticle_4 276..344 CDD:292577
Slc6a17NP_001280618.1 SLC6sbd_NTT4 60..648 CDD:271403 43/202 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 680..727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.