DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and snf-10

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_505682.2 Gene:snf-10 / 191769 WormBaseID:WBGene00004909 Length:673 Species:Caenorhabditis elegans


Alignment Length:252 Identity:56/252 - (22%)
Similarity:98/252 - (38%) Gaps:53/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SLALAARRIRSRQVHSMAVRTGSAYDTLERPYRHDKCRGRW-AKSADFYFASCTHAFSSLIFSEL 110
            |.|.|...|..:.|.::|:........:|.|    ....:| |.:|...|.:|:.  :...|..|
 Worm    48 SNATAISNIGFKSVTNLALENIGLDTKMEGP----TWTSKWEAITATLSFVTCSG--NIWFFPYL 106

  Fly   111 STFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAF-RVAPIFKGIGYA---IL 171
            ..:   :|||  |...:....:|.::|:..::..|||::|:..:|.| |:||...|:...   |:
 Worm   107 CGY---YGGW--FPYQFTFCYVFIAVPLLYLETALGQYASASPLSVFSRMAPAMAGLSAGMCFIM 166

  Fly   172 LLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNS----------------W----NTQECSL 216
            :....:|:.::|..:....:...||....||.||..|                |    :.:||..
 Worm   167 VFRTISLSVWAIYDLTIFTHASQSIWSTSPWESCQESQSGDYCVNYKLSSKCTWIQPGSDKECDE 231

  Fly   217 HENYDVDFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPA 273
            ::.           .|....|.|....|.:|.|  |||.|..    ::..:.|..|:
 Worm   232 YQE-----------MLIATRGFQQRKSPFMSFV--HGLMYKR----SITMNDWEPPS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 29/143 (20%)
Cuticle_4 276..344 CDD:292577
snf-10NP_505682.2 SNF 78..628 CDD:264495 49/222 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.