DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and snf-12

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_509527.1 Gene:snf-12 / 181143 WormBaseID:WBGene00004911 Length:1022 Species:Caenorhabditis elegans


Alignment Length:163 Identity:45/163 - (27%)
Similarity:75/163 - (46%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DTLERPYRHDKCRGRWAKSADFYFASC---------THAFSSLIFSELSTFGILHGGWLLFIIAY 127
            |.|....::|: |..|....|| |.||         |..|.:.::.        |||. :|.|.|
 Worm   146 DLLRFSKQNDR-RELWRTQKDF-FLSCLGFMVGVGHTMRFPAKVYQ--------HGGG-VFFIPY 199

  Fly   128 LMGMLFYSLPIFLIQAFLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIY 191
            |..::|:.||:..:...|||::.....:|| |:.||..|:|:|::::.:....||:|.....:.|
 Worm   200 LFSLIFFGLPLVFLHLSLGQYTGQAANTAFQRLMPIGSGVGWALVVIAIPVAVYYNIIVAWAIHY 264

  Fly   192 TVNS-----IHPVIPWMSCNNSWNTQE--CSLH 217
            ...|     :...:||.:|.:.|....  |:||
 Worm   265 FFQSAKGLLLGDELPWETCRDEWQLDNRCCNLH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 30/103 (29%)
Cuticle_4 276..344 CDD:292577
snf-12NP_509527.1 SLC6sbd 158..660 CDD:271359 41/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.