DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and snf-3

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_493910.2 Gene:snf-3 / 173493 WormBaseID:WBGene00004902 Length:600 Species:Caenorhabditis elegans


Alignment Length:170 Identity:45/170 - (26%)
Similarity:81/170 - (47%) Gaps:23/170 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            ||:|....||..:...:|        |..|.:.        :||. .|::.|::.....::||||
 Worm    30 RGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYK--------NGGG-SFLVVYMIFFCLAAVPIFL 85

  Fly   141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            ::..:||:...|.:..:.:.|:|:|:|...:::....:.|:.:.....:.|.::||..|.||.:|
 Worm    86 MEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETC 150

  Fly   206 NNSWNTQEC-SLHENYDVDFAVAVIFTLALAMG--VQSSV 242
            ||.||...| :..||:.   .:|.|..|..:.|  .|:||
 Worm   151 NNYWNDATCVTGKENFT---ELARIKALVASAGGHTQTSV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 35/123 (28%)
Cuticle_4 276..344 CDD:292577
snf-3NP_493910.2 SLC6sbd-TauT-like 30..571 CDD:271387 45/170 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.