DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and snf-2

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_492396.2 Gene:snf-2 / 172701 WormBaseID:WBGene00004901 Length:746 Species:Caenorhabditis elegans


Alignment Length:104 Identity:27/104 - (25%)
Similarity:49/104 - (47%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYS 182
            |...|:|.|::....:::|...::..|||:::....:.| |:.|..:|:|:...::......||.
 Worm   142 GGTSFLIVYIICAFVFAVPAIHMEFALGQYAAKSPPAVFRRIMPALEGVGWMTCIVGAVIGVYYM 206

  Fly   183 IAAVVPLIYTVNSIHPVIPWMSCNNSWNTQECSLHENYD 221
            |.....::|.:| |..|.....|:|.||...|     ||
 Worm   207 ILISWIVLYIIN-IFYVNNMGRCDNPWNQNNC-----YD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 26/100 (26%)
Cuticle_4 276..344 CDD:464954
snf-2NP_492396.2 rplD 5..>122 CDD:184900
SLC6sbd 113..638 CDD:271359 27/104 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.