DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and snf-1

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_491491.2 Gene:snf-1 / 172119 WormBaseID:WBGene00004900 Length:617 Species:Caenorhabditis elegans


Alignment Length:132 Identity:31/132 - (23%)
Similarity:61/132 - (46%) Gaps:8/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFL 145
            ::.|..|....:|..::..:.|:...|..|... ||..|.:.|..||.:.:....:|..:::..:
 Worm    18 EEWRDLWPSKIEFIVSAMAYLFAMTNFLNLPKL-ILENGGVAFAAAYAIVVGVLCMPTMVMEMSI 81

  Fly   146 GQFSSSGTISAF-RVAPIFKGIGYAILLLN---LGTLTYYSIAAVVPLIY---TVNSIHPVIPWM 203
            ||.:....:.|| .:.|:|:|||.:.:|..   |..:|.:.....:.|.|   |.::....:||:
 Worm    82 GQVTGRAPVLAFYHLFPVFRGIGVSQILFTMVVLACMTKFLSTLCLFLYYYFWTFHAGRSGLPWL 146

  Fly   204 SC 205
            :|
 Worm   147 NC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 22/90 (24%)
Cuticle_4 276..344 CDD:292577
snf-1NP_491491.2 SNF 21..554 CDD:264495 31/129 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.