DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and mod-5

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_491095.3 Gene:mod-5 / 171879 WormBaseID:WBGene00003387 Length:671 Species:Caenorhabditis elegans


Alignment Length:400 Identity:87/400 - (21%)
Similarity:142/400 - (35%) Gaps:120/400 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPVETESGGGMGGSLALAARRIRSRQVHSMAVR--TGSAYDTL---ERPY--------------- 78
            :.::.|...|....|:....|..||   ||:|:  |.|.|..|   ::|.               
 Worm    13 QQLQAELSSGAASMLSAPESRRVSR---SMSVKAPTASEYMPLSVADKPLTLTVSTSHSIDPNEP 74

  Fly    79 --------------------RHDKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGI 115
                                |....|.:||...:|..|...:|        |.|:.:.       
 Worm    75 IAALGGLTPTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYK------- 132

  Fly   116 LHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLT 179
             |||. .|:|.|.:.::...||:|.::..||||..||.:|.:| |.|:|:||||.|..:......
 Worm   133 -HGGG-AFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAI 195

  Fly   180 YYSIAAVVPLIYTVNSIHPV----IPWMSCNNSWNTQECS----------------------LHE 218
            :|:......:.:.:.|:..:    :||.||.|.|||..||                      |::
 Worm   196 FYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDLNVTISRNGTPLTTPSEEYYLYK 260

  Fly   219 NYDVD-------------------FAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAV 264
            ..:|.                   .||.::...||..|.|||          ..:.:...:.|.:
 Worm   261 VLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSS----------GKIVWVTATAPYI 315

  Fly   265 VASPWAVPAAHWPAAVNVASW--PPAAIHAAAPAVLAAPAPAVVAAHAP--SVVVAPVAHSGVYT 325
            :.|...:.....|.|.|...:  .|.......|||.:|.|..:..:..|  .|::|..:::....
 Worm   316 ILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNN 380

  Fly   326 AQTRGAIHTA 335
            ...|.|:.|:
 Worm   381 NCYRDAVTTS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 44/165 (27%)
Cuticle_4 276..344 CDD:292577 15/63 (24%)
mod-5NP_491095.3 SLC6sbd_SERT-like 100..639 CDD:271388 72/309 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.