DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a13

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006237280.2 Gene:Slc6a13 / 171163 RGDID:620788 Length:608 Species:Rattus norvegicus


Alignment Length:162 Identity:47/162 - (29%)
Similarity:75/162 - (46%) Gaps:42/162 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---------HGGWLLFIIAYL 128
            ||||.        :|....:|..:         :..|:...|.:         :||. .|.|.||
  Rat    29 TLERE--------QWTNKMEFVLS---------VAGEIIGLGNVWRFPYLCYKNGGG-AFFIPYL 75

  Fly   129 MGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VAPIFK------GIGYA----ILLLNLGTLTYYS 182
            :.:....:|:|.::..|||:::.|.|:|:| :.|||:      |||||    :.|||:    ||.
  Rat    76 IFLFTCGIPVFFLETALGQYTNQGGITAWRKICPIFEASVPSPGIGYASQMIVSLLNV----YYI 136

  Fly   183 IAAVVPLIYTVNSIHPVIPWMSCNNSWNTQEC 214
            :.....|.|..:|....:||.||::.|||:.|
  Rat   137 VVLAWALFYLFSSFTTDLPWGSCSHEWNTENC 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 37/103 (36%)
Cuticle_4 276..344 CDD:292577
Slc6a13XP_006237280.2 SLC5-6-like_sbd 32..581 CDD:382020 44/159 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11616
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.