DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a9

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001342104.1 Gene:Slc6a9 / 14664 MGIID:95760 Length:652 Species:Mus musculus


Alignment Length:135 Identity:41/135 - (30%)
Similarity:73/135 - (54%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQAFL 145
            ||.|....:|...|..:|..   ...:..|..|   :||. .|:..|.:.::|..:|:|.::...
Mouse    46 RGNWGNQIEFVLTSVGYAVG---LGNVWRFPYLCYRNGGG-AFMFPYFIMLIFCGIPLFFMELSF 106

  Fly   146 GQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWN 210
            |||:|.|.:..:|::|:|||:||.:::::.....||::...:...|..:|:..|:||..|||.||
Mouse   107 GQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWN 171

  Fly   211 TQECS 215
            |.:|:
Mouse   172 TPDCA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 31/93 (33%)
Cuticle_4 276..344 CDD:464954
Slc6a9NP_001342104.1 SLC6sbd_GlyT1 30..613 CDD:212067 41/135 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.