DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a3

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_034150.1 Gene:Slc6a3 / 13162 MGIID:94862 Length:619 Species:Mus musculus


Alignment Length:211 Identity:48/211 - (22%)
Similarity:86/211 - (40%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            |..|:|..||..:....|        |..|.:.        :||. .|::.||:.|:...:|:|.
Mouse    60 RETWSKKIDFLLSVIGFAVDLANVWRFPYLCYK--------NGGG-AFLVPYLLFMVIAGMPLFY 115

  Fly   141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            ::..||||:..|....:::.|:.||:|:.::|::.....:|::.....|.|..:|....:||:.|
Mouse   116 MELALGQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC 180

  Fly   206 NNSWNTQECS--------------------------------LHENYDVD-------------FA 225
            ||:||:..||                                ||::..:|             ..
Mouse   181 NNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLTACLVL 245

  Fly   226 VAVIFTLALAMGVQSS 241
            |.|:...:|..||::|
Mouse   246 VIVLLYFSLWKGVKTS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 38/164 (23%)
Cuticle_4 276..344 CDD:292577
Slc6a3NP_034150.1 SLC5-6-like_sbd 60..613 CDD:294310 48/211 (23%)
Interaction with TGFB1I1. /evidence=ECO:0000250 560..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.