Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_579830.1 | Gene: | Slc6a20 / 113918 | RGDID: | 621651 | Length: | 616 | Species: | Rattus norvegicus |
Alignment Length: | 253 | Identity: | 57/253 - (22%) |
---|---|---|---|
Similarity: | 102/253 - (40%) | Gaps: | 57/253 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 DKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQ 142
Fly 143 AFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC- 205
Fly 206 ---NNSWNTQEC-------------------SLHENYDVDFAVAVIFTLALAM-------GVQSS 241
Fly 242 ---------------VIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVNVAS 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 35/165 (21%) |
Cuticle_4 | 276..344 | CDD:292577 | 3/9 (33%) | ||
Slc6a20 | NP_579830.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | 57/253 (23%) | |
SLC5-6-like_sbd | 26..601 | CDD:294310 | 57/253 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |