DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a20

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_579830.1 Gene:Slc6a20 / 113918 RGDID:621651 Length:616 Species:Rattus norvegicus


Alignment Length:253 Identity:57/253 - (22%)
Similarity:102/253 - (40%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQ 142
            :|.|.:|.....|.||..::|..   ...:..|..|   :||. .|::.||:.::...:|:..::
  Rat    26 EKARPQWGNPLQFVFACISYAVG---LGNVWRFPYLCQMYGGG-SFLVPYLIMLIVEGMPLLYLE 86

  Fly   143 AFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC- 205
            ..:||....|:|.|:| ::|...|:|.|.::::.....||::.......|..:|....:||..| 
  Rat    87 LAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWGFWYLFHSFQDPLPWSVCP 151

  Fly   206 ---NNSWNTQEC-------------------SLHENYDVDFAVAVIFTLALAM-------GVQSS 241
               |.:...:||                   |:.||..|.:..|:..|||..|       |.:|:
  Rat   152 LNSNRTGYDEECEKASSTQYFWYRKTLNISPSIQENGGVQWEPALCLTLAWLMVYLCILRGTEST 216

  Fly   242 ---------------VIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVNVAS 284
                           :|.|:..:..||    |.:|...:.:|.....|:..|.:|.|:
  Rat   217 GKVVYFTALMPYCVLIIYLVRGLTLHG----ATNGLMYMFTPKIEQLANPKAWINAAT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 35/165 (21%)
Cuticle_4 276..344 CDD:292577 3/9 (33%)
Slc6a20NP_579830.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 57/253 (23%)
SLC5-6-like_sbd 26..601 CDD:294310 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.