DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a5

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006540608.1 Gene:Slc6a5 / 104245 MGIID:105090 Length:831 Species:Mus musculus


Alignment Length:439 Identity:94/439 - (21%)
Similarity:140/439 - (31%) Gaps:164/439 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137
            :|.||.|:...||..:...:|        |..|.|.        :||. .|:|.|||.:....||
Mouse   222 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQ--------NGGG-AFLIPYLMMLALAGLP 277

  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202
            ||.::..||||:|.|.:|.::..|..:|.|.|:|::::....||::.....|.|...|...|:||
Mouse   278 IFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPW 342

  Fly   203 MSCNNSWNTQEC------------------------------------------------SLHEN 219
            .||||.|||.||                                                |..|.
Mouse   343 GSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEE 407

  Fly   220 Y----------------DVDFAVA-------VIFTLALAMGVQSSVIPLLSQVAGHGLSYTA--- 258
            |                ::.:.:|       ||...:||.|::||         |..:.:||   
Mouse   408 YFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSS---------GKVVYFTATFP 463

  Fly   259 -----------VSGPAVVASPWAVPAAHWPAAVNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPS 312
                       |:.|...|..|......|....:...|..||......  |:|            
Mouse   464 YVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFS--LSA------------ 514

  Fly   313 VVVAPVAHSGVYTAQTRGAIH----------------TAPLAGHIL-----HQCRSRTRNL--VR 354
                  |..|:.|..:....|                |:..||.::     .....|..|:  |.
Mouse   515 ------AWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVA 573

  Fly   355 SIPPSIPLSIGPLPLPRILPLMGKSNFRPLNTLCKYIVYIAIYRQGTRT 403
            ...|.|...:.|..|.|:          ||:.....|.::.:...|..|
Mouse   574 DQGPGIAFVVYPEALTRL----------PLSPFWAIIFFLMLLTLGLDT 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 49/190 (26%)
Cuticle_4 276..344 CDD:292577 13/88 (15%)
Slc6a5XP_006540608.1 SLC6sbd_GlyT2 225..821 CDD:271389 93/436 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.