DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and slc6a17

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_002933031.1 Gene:slc6a17 / 100490416 XenbaseID:XB-GENE-964419 Length:725 Species:Xenopus tropicalis


Alignment Length:259 Identity:53/259 - (20%)
Similarity:104/259 - (40%) Gaps:62/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SEHGTELPGDFIG--EPVETESGGGMGGSLALAARRIRSRQVHSMAVRTGSAYDTLERPYRHDKC 83
            ::|.||...|.:.  ||::.::     .:|.::::..:.:|:...:       :..:||      
 Frog    14 NQHVTESVADLLAHEEPIDHKA-----SALNVSSQDSQPKQLEDSS-------ELEDRP------ 60

  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQAFL 145
              .|.....:..|...:   |:....:..|..|   :||. .:::.||:.::...:|:|.::..:
 Frog    61 --AWNNKLQYILAQIGY---SVGLGNVWRFPYLCQKNGGG-AYMVPYLILLIIIGIPLFFLELAV 119

  Fly   146 GQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC---- 205
            ||....|:|..:. :.|...|||||..::......||::.....:.|...|....:||..|    
 Frog   120 GQRIRRGSIGVWNYICPRLGGIGYASCVVCFFVGLYYNVIIGWSIFYFFQSFQYPLPWNECPTVK 184

  Fly   206 NNSWNT--QEC-------------------SLHE----NYDVDFAVAVIFT---LALAMGVQSS 241
            |.|.|.  .||                   |:.|    |:.:...:.|.:|   :|:..|:|||
 Frog   185 NGSVNVVEAECDKSSATTFFWYREALDISNSISEGGGLNWKMTLCLLVAWTMVCMAMIKGIQSS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 36/152 (24%)
Cuticle_4 276..344 CDD:292577
slc6a17XP_002933031.1 SLC6sbd_NTT4 59..647 CDD:271403 45/202 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.