Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001313379.1 | Gene: | slc6a14 / 100150665 | ZFINID: | ZDB-GENE-130411-2 | Length: | 614 | Species: | Danio rerio |
Alignment Length: | 220 | Identity: | 48/220 - (21%) |
---|---|---|---|
Similarity: | 88/220 - (40%) | Gaps: | 61/220 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 DTLERPYRHDK--CRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIA 126
Fly 127 YLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIY 191
Fly 192 TVNSIHPVIPW--MSCNNS-------------------------WNTQECSLHENYDVDFAVAVI 229
Fly 230 FTLALAM-------------GVQSS 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 36/159 (23%) |
Cuticle_4 | 276..344 | CDD:292577 | |||
slc6a14 | NP_001313379.1 | SLC6sbd_ATB0 | 42..612 | CDD:271391 | 45/206 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |