DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and si:ch211-132b12.1

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001076533.1 Gene:si:ch211-132b12.1 / 100034467 ZFINID:ZDB-GENE-050420-315 Length:586 Species:Danio rerio


Alignment Length:140 Identity:40/140 - (28%)
Similarity:70/140 - (50%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            ||.|....:|..|...:.        |..|.:.        :||. .|:|.||:.::...:|:||
Zfish    11 RGYWGSKMEFLLAVAGNVVGLGNVWRFPYLCYK--------YGGG-AFLIPYLVFVVTCGVPLFL 66

  Fly   141 IQAFLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMS 204
            ::..:||::..|.::.: |:.|:.:||||...|:.|.:..||.:.....|.|.:.|....:||.:
Zfish    67 LEMAMGQYTQQGGVTCWHRLCPLAEGIGYGGQLILLYSCMYYIVILAWALFYLIFSFKSQLPWAT 131

  Fly   205 CNNSWNTQEC 214
            |:|:|||.:|
Zfish   132 CDNTWNTDDC 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 31/93 (33%)
Cuticle_4 276..344 CDD:464954
si:ch211-132b12.1NP_001076533.1 SLC6sbd-TauT-like 11..549 CDD:271387 40/140 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.