DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur29B and D6Ertd527e

DIOPT Version :9

Sequence 1:NP_723377.1 Gene:Mur29B / 319014 FlyBaseID:FBgn0051901 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001161409.1 Gene:D6Ertd527e / 52372 MGIID:1261919 Length:464 Species:Mus musculus


Alignment Length:457 Identity:164/457 - (35%)
Similarity:251/457 - (54%) Gaps:60/457 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RSLLSVMPRAADDDSTTGSTTIEDSSTTASASTT-----DSSTASSTTIGESSSSSLGSSTSDSS 126
            ||.||    :...|::|.|.|..|:||:.|.||:     :||:.||.......||||.||:|:||
Mouse    17 RSSLS----SRSSDTSTSSDTSSDTSTSTSTSTSTSHSNNSSSNSSRKPSNKGSSSLSSSSSNSS 77

  Fly   127 TSDSTTDSSTA----SSTTIGDSSSSSLGSSTSDSSTSDSTTDSSTASSTTIGDSSTSSLGSSTS 187
            :..|.|||:::    ||.:..::.||||.||:|:|| ..|.|.||:.||::...|..|:.|||:|
Mouse    78 SKPSDTDSNSSSISCSSNSPSNTDSSSLSSSSSNSS-RPSNTGSSSLSSSSSNSSRPSNTGSSSS 141

  Fly   188 DSSTSDSTTDSSTASST--TIGDSSTSSLGSSTSDSSTSDST-TDSSTASST-----------TI 238
            .||.|.:.::||...|.  :|.:...||..||...||.:.|. ..|:|.||:           |:
Mouse   142 SSSNSSNISNSSIRPSNRGSISNYDNSSNSSSPQPSSGNISNRRPSNTGSSSNQVNSGPRPGNTV 206

  Fly   239 GDSSTSSLG---SSTSDSSNSDSTTDSSTVSSTTIGDSSSSSLGSSTSDSST---SDSTTDSSTA 297
            ..|:.|:.|   |:|:.||||.|.:.....:..:|.:.|:|||..|...:.:   :.||..|:.|
Mouse   207 NISNYSNSGPRPSNTTTSSNSQSNSSPRPSNRGSISNYSNSSLRPSNRGNISNYDNSSTRPSNRA 271

  Fly   298 SSTTIGDSSSSSLGSSTSDSSTSDSTTDSSTASST-----------TIGDSSTSSLGSSTSD-SS 350
            :.:..|:||:||  |....||...:...|:|.||:           |:..|:.|:.|...|: :|
Mouse   272 NISNYGNSSNSS--SPQPSSSKISNRRPSNTGSSSNQVNSGPRPGNTVNISNYSNSGPRPSNTTS 334

  Fly   351 TSDSTTDSSTASSTTIGDSSSSSLGSSTSDSSTYDSTTDSSTASSTTIGDS----SSSSLGSSTS 411
            :|:|.::||..||.|  |||||...|.||.||:  |::.||::||::.|:|    |.:...||.|
Mouse   335 SSNSQSNSSPRSSNT--DSSSSPGNSHTSSSSS--SSSSSSSSSSSSRGNSGPRPSKTGSISSQS 395

  Fly   412 DSSTSDSTTDSSTASS----TTIGDSSSSSLGSSTTDSSTVSSTTNAGSTASSTTSSPSISTSTS 472
            :|....|.||||::||    .|...||||:..||:..|.:.||::::.|::.|.:||.|.|:.:.
Mouse   396 NSGPRSSNTDSSSSSSPGNIKTSSSSSSSNSSSSSHSSYSCSSSSHSSSSSRSHSSSHSHSSHSR 460

  Fly   473 SP 474
            :|
Mouse   461 TP 462



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.