DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42367 and IME2

DIOPT Version :9

Sequence 1:	NP_723502.2	Gene:	CG42367 / 318998	FlyBaseID:	FBgn0259713	Length:	103	Species:	Drosophila melanogaster
Sequence 2:	NP_012429.1	Gene:	IME2 / 853338	SGDID:	S000003642	Length:	645	Species:	Saccharomyces cerevisiae

Alignment Length:	55	Identity:	17/55 - (30%)
Similarity:	22/55 - (40%)	Gaps:	11/55 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 DELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYT 84
            ||.|..|.....:|: |...|        |.||:.|.|..||  .|....:.|:|
Yeast   570 DEDIVLPYVNNSNYT-HTDRS--------HHRGDNVLGDASL--GDSFNSMPDFT 613

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42367	NP_723502.2	Chitin_bind_4	39..86	CDD:278791	13/46 (28%)
IME2	NP_012429.1	STKc_MAK_like	38..386	CDD:270824
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0661
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900