DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cilk1

DIOPT Version :9

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_620241.1 Gene:Cilk1 / 84411 RGDID:71050 Length:629 Species:Rattus norvegicus


Alignment Length:102 Identity:21/102 - (20%)
Similarity:34/102 - (33%) Gaps:35/102 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHPDELIASPAQYEFHYSVHDSH------------SGDVKDQFEHRRGEY--------------- 64
            ||..|...:|   .|..|:|:.:            |||:|.:...|.|..               
  Rat   359 SHVQEGQPNP---PFFPSLHNKNLPPKILAGLEQKSGDMKPKSRRRWGLISRSTKGSDDWADLAD 420

  Fly    65 --VTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRREP 99
              .:...:.:|....:|..|   |||..|.:.:..:|
  Rat   421 LDFSSSLTRIDVKNKKRQSD---DPLCRFESVLDLKP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 12/75 (16%)
Cilk1NP_620241.1 STKc_MAK_like 4..284 CDD:270824
S_TKc 4..284 CDD:214567
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..482 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..629
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.