DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42367 and MOK

DIOPT Version :9

Sequence 1:	NP_723502.2	Gene:	CG42367 / 318998	FlyBaseID:	FBgn0259713	Length:	103	Species:	Drosophila melanogaster
Sequence 2:	NP_055041.1	Gene:	MOK / 5891	HGNCID:	9833	Length:	419	Species:	Homo sapiens

Alignment Length:	92	Identity:	23/92 - (25%)
Similarity:	33/92 - (35%)	Gaps:	35/92 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 CL-ILSALVAVQAGIIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDP 74
            || :|.|:||..       |||.||:....:..|             |:.:|   .|.:.:|
Human   258 CLSLLHAMVAYD-------PDERIAAHQALQHPY-------------FQEQR---KTEKRAL--- 296

  Fly    75 DGHRRIVDYTADPLLGFNAQVRREPIS 101
             |..|...:...|       |..||:|
Human   297 -GSHRKAGFPEHP-------VAPEPLS 315

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42367	NP_723502.2	Chitin_bind_4	39..86	CDD:278791	7/46 (15%)
MOK	NP_055041.1	STKc_MOK	4..285	CDD:270825	12/46 (26%)
		S_TKc	4..285	CDD:214567	12/46 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	285..344		11/45 (24%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	390..419
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0661
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900