DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and CG34461

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster


Alignment Length:112 Identity:44/112 - (39%)
Similarity:60/112 - (53%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVICLILSALVAVQAGI------------IASHP-----DELIASPAQYEFHYSVHDSHSGDVKD 55
            :.|.|:.:|..||...:            :.||.     .|.:|.| :|.|:|.:.|.|:||:|.
  Fly     5 VAIALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYP-KYSFNYGIKDPHTGDIKS 68

  Fly    56 QFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRREPISR 102
            |.|.|.|:.|.|:||||:|||..|.||||||...||||.|.:...|:
  Fly    69 QAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPSK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 26/46 (57%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.