DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and LOC4578438

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_001238117.2 Gene:LOC4578438 / 4578438 VectorBaseID:AGAMI1_006281 Length:135 Species:Anopheles gambiae


Alignment Length:92 Identity:45/92 - (48%)
Similarity:64/92 - (69%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLILSALVAVQAGI--IASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVD 73
            |::.:.:.|..|.:  :|....|...:||:|:|.|||||.|:||:|.|.|.|.|:.|.|:|:|:|
Mosquito     6 CIVFAVVAAASAAVLPVAVKHIEYADAPAEYQFEYSVHDDHTGDIKSQHEERHGDNVVGQYTLID 70

  Fly    74 PDGHRRIVDYTADPLLGFNAQVRREPI 100
            .||:||:|:||||...||||.|||||:
Mosquito    71 ADGYRRVVEYTADEHNGFNAVVRREPV 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 27/46 (59%)
LOC4578438XP_001238117.2 None

Return to query results.
Submit another query.