DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:95 Identity:37/95 - (38%)
Similarity:52/95 - (54%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HSSIVICLILSALVAVQAGII----ASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYV 65
            |:.:.....|.:....|..::    ..|.:...|.| :|.|.|:|:|.|:||.|.|.|.|.|:.|
  Fly  1119 HAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHP-RYAFEYAVNDPHTGDNKHQKEERDGDVV 1182

  Fly    66 TGRYSLVDPDGHRRIVDYTADPLLGFNAQV 95
            .|.||||:|||:.|.|.|.||...||:|:|
  Fly  1183 KGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 25/46 (54%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 27/51 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.