DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr76Bc

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:102 Identity:42/102 - (41%)
Similarity:54/102 - (52%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILSALV----------AVQAG---IIASHPDELIASPAQYE-----FHYSVHDSHSGDVKDQFEH 59
            ||.||:          ||:.|   ::....||.:.....||     |.|.|.|.|:||||.|:|.
  Fly    12 ILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWES 76

  Fly    60 RRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVR 96
            |.|:.|.|.||:::|||..|.|.||||...||||.|:
  Fly    77 RDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 26/51 (51%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.