DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:70 Identity:33/70 - (47%)
Similarity:46/70 - (65%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGF 91
            ||.:|....| :|||:|.|.|:.:||:|.|:|.|.|:.|.|.|::.:.||..|||:||||...||
  Fly    89 SHHEEPKHHP-KYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGF 152

  Fly    92 NAQVR 96
            .|.|:
  Fly   153 QATVK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 23/46 (50%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 25/51 (49%)

Return to query results.
Submit another query.