powered by:
Protein Alignment CG42367 and Cpr72Ea
DIOPT Version :9
Sequence 1: | NP_723502.2 |
Gene: | CG42367 / 318998 |
FlyBaseID: | FBgn0259713 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648882.1 |
Gene: | Cpr72Ea / 39814 |
FlyBaseID: | FBgn0036617 |
Length: | 341 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 30/71 - (42%) |
Gaps: | 12/71 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 DELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT-GRYSLVDPDGHRRIVDYTADPLLGFNA 93
||| .||.:.| |..:..:.|.|..:.:| |.||..|..|..:.|:|.||. .||:.
Fly 44 DEL----GQYSYGY------SEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFHV 97
Fly 94 QVRREP 99
.....|
Fly 98 AATNLP 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45453302 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.