DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and CG13670

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:79 Identity:33/79 - (41%)
Similarity:45/79 - (56%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVAVQAGIIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIV 81
            ||.|..|....:    :|.| :|.|.|.|.|..:..::::.|.|.|:.|.|.||:|||||..|:|
  Fly    86 LVTVHDGRTVDY----VARP-EYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVV 145

  Fly    82 DYTADPLLGFNAQV 95
            .||||...||.|:|
  Fly   146 KYTADDANGFQAEV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 21/46 (46%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:459790 23/51 (45%)

Return to query results.
Submit another query.