DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:54 Identity:17/54 - (31%)
Similarity:25/54 - (46%) Gaps:3/54 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQ 94
            :.|.:..:....:|:  |...|....|.||.:.|:|....|.||||. .||:.|
  Fly    37 YAYDIEQASGIQIKE--EGLAGHEAHGSYSYISPEGIPVQVVYTADE-FGFHPQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 12/44 (27%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 14/49 (29%)

Return to query results.
Submit another query.