DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:153 Identity:45/153 - (29%)
Similarity:61/153 - (39%) Gaps:54/153 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLHSSIVICLILSALVAV--------------------QAGIIASHPDELIASPA---------- 37
            :..:..|:.|||||:||:                    .|..|:....:|:|:||          
  Fly     2 IAQTLFVLGLILSAVVAIPIDPYGLSAPGLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISY 66

  Fly    38 ------------------------QYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHR 78
                                    ||.|.|.|.|.|:||.|.|.|......|.|.|||.:|||..
  Fly    67 APKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTI 131

  Fly    79 RIVDYTADPLLGFNAQVRREPIS 101
            |.|.||||.:.||||.|.::.::
  Fly   132 RKVTYTADKVNGFNAVVEKKGVA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 23/46 (50%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.