DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr62Bc

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_647668.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:108 Identity:46/108 - (42%)
Similarity:59/108 - (54%) Gaps:21/108 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VICLILSALVAVQAGIIASHPDEL-IASPA------------------QYEFHYSVHDSHSGDVK 54
            :||  |:.|.|..||::..|...| .|:||                  :|.::|.|.|||:||||
  Fly     7 LIC--LAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVK 69

  Fly    55 DQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRR 97
            .|.|.|.|:.|.|.||||:|||..|.|:||||...||||.|.:
  Fly    70 SQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 27/46 (59%)
Cpr62BcNP_647668.1 Chitin_bind_4 54..106 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.