DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr56F

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:71 Identity:29/71 - (40%)
Similarity:40/71 - (56%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQ 94
            ||....||:|||.|.|.|..||:.....|.|.|:...|||.::.|||.::||:|.||. .|:...
  Fly   119 DEEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYRPT 182

  Fly    95 VRREPI 100
            :|.|.:
  Fly   183 IRYEQV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 20/46 (43%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 22/51 (43%)

Return to query results.
Submit another query.