DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and resilin

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:63 Identity:28/63 - (44%)
Similarity:42/63 - (66%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRRE 98
            ||:|||:|.|.|:.||......|.|.|::.||:|:::.|||.::||:|.||. .|:..|:|.|
  Fly   342 PAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEADQ-QGYRPQIRYE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 20/46 (43%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 22/51 (43%)

Return to query results.
Submit another query.