DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr76Bc

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_565332.3 Gene:Cpr76Bc / 3290257 VectorBaseID:AGAMI1_000315 Length:392 Species:Anopheles gambiae


Alignment Length:90 Identity:41/90 - (45%)
Similarity:52/90 - (57%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILSALVAVQAGIIASHPDEL------IASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSL 71
            :::.|.:...|:.:.:.|.|      .|.|| |.|.|.|.|.||||||.|:|.|....|.|.||:
Mosquito     8 LMAILASASIGLASCYKDSLHAYAPEYAHPA-YSFSYGVKDLHSGDVKSQWETRDDGIVKGHYSV 71

  Fly    72 VDPDGHRRIVDYTADPLLGFNAQVR 96
            |:|||..|.||||||...||||.|:
Mosquito    72 VEPDGSIREVDYTADSKTGFNAVVK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 27/46 (59%)
Cpr76BcXP_565332.3 None

Return to query results.
Submit another query.