DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr66D

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_556966.3 Gene:Cpr66D / 3290137 VectorBaseID:AGAMI1_014268 Length:256 Species:Anopheles gambiae


Alignment Length:66 Identity:29/66 - (43%)
Similarity:41/66 - (62%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRRE 98
            |:|: |:|.:.|.|....:.:::.|.|.|..:.|.||:||.||..|.|.|||||..||.|:|.|:
Mosquito   138 ANPS-YQFGFDVKDDEFTNYQNRKEQRDGNVIKGSYSVVDSDGFIRTVTYTADPKEGFKAEVSRQ 201

  Fly    99 P 99
            |
Mosquito   202 P 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 18/46 (39%)
Cpr66DXP_556966.3 Chitin_bind_4 142..194 CDD:459790 21/51 (41%)

Return to query results.
Submit another query.