DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr31A

DIOPT Version :9

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:95 Identity:45/95 - (47%)
Similarity:60/95 - (63%) Gaps:9/95 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSALVAVQAGI---IASHPD-----ELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYS 70
            |:|...|.|.:   :|:.|.     ||.:|| :|:|.|.||||.:||:|.|.|.|.|..|.|.||
  Fly   103 LAAAPVVAAPVVKTVAAAPAVLKQVELESSP-RYDFSYGVHDSITGDIKSQVETRDGGNVVGSYS 166

  Fly    71 LVDPDGHRRIVDYTADPLLGFNAQVRREPI 100
            ::|.||.:|.|.||||.:.||||.|:|||:
  Fly   167 VLDADGFKRTVTYTADDINGFNAVVQREPV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 25/46 (54%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.