DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr31A

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:95 Identity:45/95 - (47%)
Similarity:60/95 - (63%) Gaps:9/95 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSALVAVQAGI---IASHPD-----ELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYS 70
            |:|...|.|.:   :|:.|.     ||.:|| :|:|.|.||||.:||:|.|.|.|.|..|.|.||
  Fly   103 LAAAPVVAAPVVKTVAAAPAVLKQVELESSP-RYDFSYGVHDSITGDIKSQVETRDGGNVVGSYS 166

  Fly    71 LVDPDGHRRIVDYTADPLLGFNAQVRREPI 100
            ::|.||.:|.|.||||.:.||||.|:|||:
  Fly   167 VLDADGFKRTVTYTADDINGFNAVVQREPV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 25/46 (54%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.