DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42367 and Cpr62Bc

DIOPT Version :10

Sequence 1:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_308914.4 Gene:Cpr62Bc / 1270234 VectorBaseID:AGAMI1_001634 Length:212 Species:Anopheles gambiae


Alignment Length:92 Identity:42/92 - (45%)
Similarity:59/92 - (64%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VICLILSALVAVQAGII---ASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYS 70
            ::||.:..:.|  ||::   ..:..:..|.| :|.::|.||||.:||||.|.|.|.|:.|.|:||
Mosquito     7 LVCLAVLGVAA--AGVVPLATEYQGDYYAHP-KYSYNYGVHDSLTGDVKSQVESRDGDVVKGQYS 68

  Fly    71 LVDPDGHRRIVDYTADPLLGFNAQVRR 97
            ||:|||..|.||||||.:.||||.|.:
Mosquito    69 LVEPDGSVRTVDYTADDVNGFNAVVSK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 28/46 (61%)
Cpr62BcXP_308914.4 Chitin_bind_4 37..89 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.