DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr92F

DIOPT Version :10

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:101 Identity:35/101 - (34%)
Similarity:52/101 - (51%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPL 106
            |..:.::|...|.::.  |.:|.|..| ...|.|:.||..|::::|.||:|.|:|||||....|.
  Fly    32 PHSHTYSYGYADPNSQ--KHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQ 93

  Fly   107 GQKVIKAAPIAKLLAPAPLPLAYAAPKLLAPAKLPL 142
            ..:| .|||:   .|.|....|| ||....|..:|:
  Fly    94 APQV-HAAPV---YAAAHAHGAY-APYAHGPIHIPV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 16/51 (31%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 16/49 (33%)

Return to query results.
Submit another query.