DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr92F

DIOPT Version :9

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:101 Identity:35/101 - (34%)
Similarity:52/101 - (51%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPL 106
            |..:.::|...|.::.  |.:|.|..| ...|.|:.||..|::::|.||:|.|:|||||....|.
  Fly    32 PHSHTYSYGYADPNSQ--KHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQ 93

  Fly   107 GQKVIKAAPIAKLLAPAPLPLAYAAPKLLAPAKLPL 142
            ..:| .|||:   .|.|....|| ||....|..:|:
  Fly    94 APQV-HAAPV---YAAAHAHGAY-APYAHGPIHIPV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 16/51 (31%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.